Titre:x escort | x gerçek escort bayan | x eskort
La description :click here to proceed ....
Server:Apache...
L'adresse IP principale: 208.91.197.66,Votre serveur United States,Austin ISP:Confluence Networks Inc TLD:com Code postal:us
Ce rapport est mis à jour en 31-Jul-2018
Created Date: | 2017-09-28 |
Changed Date: | 2017-12-05 |
Geo IP vous fournit comme la latitude, la longitude et l'ISP (Internet Service Provider) etc. informations. Notre service GeoIP a trouvé l'hôte carsambanovada.com.Actuellement, hébergé dans United States et son fournisseur de services est Confluence Networks Inc .
Latitude: | 30.267150878906 |
Longitude: | -97.743057250977 |
Pays: | United States (us) |
Ville: | Austin |
Région: | Texas |
ISP: | Confluence Networks Inc |
domaine | Titre |
---|---|
kahramanmarasevdenevenakliyat.info | kahranmaraş escort | maraş gerçek escort bayan |
sanliurfaemlak.info | Şanlıurfa escort | urfa gerçek escort bayan |
kastamonu-escortbayanlar2.xyz | vip escort | vip gerçek escort bayan | efsane | |
karaman-escortbayanlar.xyz | vip escort | vip gerçek escort bayan | efsane | |
carsambanovada.com | x escort | x gerçek escort bayan | x eskort |
vannakliyatambari.info | van escort van gerçek escort bayan |
bayburtkarate.com | bayburt gerçek escort |
sivasgazetesi.info | sivas escort - sivas gerçek escort bayan |
bergamaescortbayan.xyz | bergama escort | bergama gerçek escort bayan - |
yalovahotel.info | yalova escort -yalova gerçek escort bayan |
afyonisrehberi.net | afyon escort | afyon gerçek escort bayan |
didimdekiralikyazlik.info | didim escort | didim gerçek escort bayan |
malatyagazetesi.info | malatya escort | malatya gerçek escort | malatya escort bayan - |
kariyerduzce.com | düzce escort | düzce gerçek escort bayan | düzce eskort |
samsunsev.com | samsun escort | samsun gerçek escort bayan | samsun eskort |
Les informations d'en-tête HTTP font partie du protocole HTTP que le navigateur d'un utilisateur envoie à appelé Apache contenant les détails de ce que le navigateur veut et acceptera de nouveau du serveur Web.
Content-Length: | 1459 |
Content-Encoding: | gzip |
Connection: | Keep-Alive |
Keep-Alive: | timeout=5, max=122 |
X-Adblock-Key: | MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAKX74ixpzVyXbJprcLfbH4psP4+L2entqri0lzh6pkAaXLPIcclv6DQBeJJjGFWrBIF6QMyFwXT5CCRyjS2penECAwEAAQ==_mrtDk5Z7hNSA7UnM/bFAOXEiVAi53fBonQmdrfZWRI2CDl4pEDQzZQMhtyy5wMhfUrSwwto07TAIt5Zq+hyYIw== |
ntCoent-Length: | 2811 |
Cache-Control: | private |
Date: | Tue, 31 Jul 2018 02:32:02 GMT |
Server: | Apache |
Content-Type: | text/html; charset=UTF-8 |
soa: | sk.s5.ans1.ns109.ztomy.com. abuse.opticaljungle.com. 2011062801 3600 900 604800 86400 |
txt: | "v=spf1 a -all" |
ns: | sk.s5.ans2.ns109.ztomy.com. sk.s5.ans1.ns109.ztomy.com. |
ipv4: | IP:208.91.197.66 ASN:40034 OWNER:CONFLUENCE-NETWORK-INC - Confluence Networks Inc, VG Country:VG |
click here to proceed .
Whois est un protocole qui permet d'accéder aux informations d'enregistrement.Vous pouvez atteindre quand le site Web a été enregistré, quand il va expirer, quelles sont les coordonnées du site avec les informations suivantes. En un mot, il comprend ces informations;
Domain Name: CARSAMBANOVADA.COM
Registry Domain ID: 2168554407_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-12-05T15:26:06Z
Creation Date: 2017-09-28T19:07:27Z
Registry Expiry Date: 2018-09-28T19:07:27Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: WALT.NS.CLOUDFLARE.COM
Name Server: WANDA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-12-05T19:10:41Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
REGISTRAR GoDaddy.com, LLC
SERVERS
SERVER com.whois-servers.net
ARGS domain =carsambanovada.com
PORT 43
TYPE domain
RegrInfo
DOMAIN
NAME carsambanovada.com
CHANGED 2017-12-05
CREATED 2017-09-28
STATUS
clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
clientRenewProhibited https://icann.org/epp#clientRenewProhibited
clientTransferProhibited https://icann.org/epp#clientTransferProhibited
clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
NSERVER
WALT.NS.CLOUDFLARE.COM 173.245.59.148
WANDA.NS.CLOUDFLARE.COM 173.245.58.240
REGISTERED yes
La liste suivante vous montre les fautes d'orthographe possibles des internautes pour le site Web recherché.